Lineage for d1bg3b2 (1bg3 B:223-465)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586265Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families) (S)
    duplication contains two domains of this fold
  5. 586454Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 586468Protein Mammalian type I hexokinase [53086] (2 species)
    further duplication: consists of two very similar lobes
  7. 586498Species Rat (Rattus norvegicus) [TaxId:10116] [53088] (1 PDB entry)
  8. 586504Domain d1bg3b2: 1bg3 B:223-465 [33496]

Details for d1bg3b2

PDB Entry: 1bg3 (more details), 2.8 Å

PDB Description: rat brain hexokinase type i complex with glucose and inhibitor glucose-6-phosphate

SCOP Domain Sequences for d1bg3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bg3b2 c.55.1.3 (B:223-465) Mammalian type I hexokinase {Rat (Rattus norvegicus)}
qcevgliigtgtnacymeelrhidlvegdegrmcintewgafgddgsledirtefdreld
rgslnpgkqlfekmvsgmymgelvrlilvkmakegllfegritpelltrgkfntsdvsai
ekdkegiqnakeiltrlgvepsdvdcvsvqhictivsfrsanlvaatlgailnrlrdnkg
tprlrttvgvdgslykmhpqysrrfhktlrrlvpdsdvrfllsesgtgkgaamvtavayr
lae

SCOP Domain Coordinates for d1bg3b2:

Click to download the PDB-style file with coordinates for d1bg3b2.
(The format of our PDB-style files is described here.)

Timeline for d1bg3b2: