Lineage for d5mzyb_ (5mzy B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2493292Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2493293Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2493579Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2493580Protein automated matches [191112] (16 species)
    not a true protein
  7. 2493688Species Myxococcus xanthus [TaxId:246197] [334864] (8 PDB entries)
  8. 2493691Domain d5mzyb_: 5mzy B: [334955]
    automated match to d1poib_
    complexed with 8ez, act, gol

Details for d5mzyb_

PDB Entry: 5mzy (more details), 1.6 Å

PDB Description: crystal structure of the decarboxylase aiba/aibb in complex with a possible transition state analog
PDB Compounds: (B:) Glutaconate CoA-transferase family, subunit B

SCOPe Domain Sequences for d5mzyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mzyb_ c.124.1.0 (B:) automated matches {Myxococcus xanthus [TaxId: 246197]}
atlditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylacvgsldp
eiptllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmtasgsl
dkprtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisdlgvf
elgasgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphgyrda
lvga

SCOPe Domain Coordinates for d5mzyb_:

Click to download the PDB-style file with coordinates for d5mzyb_.
(The format of our PDB-style files is described here.)

Timeline for d5mzyb_: