SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vvwe1 (5vvw E:16-103)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097464Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2097465Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2097487Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. 2097488Protein automated matches [254548] (5 species)
    not a true protein
  7. 2291645Species Pseudomonas aeruginosa [TaxId:208964] [334946] (1 PDB entry)
  8. 2291652Domain d5vvwe1: 5vvw E:16-103 [334953]
    Other proteins in same PDB: d5vvwa2, d5vvwa3, d5vvwb2, d5vvwb3, d5vvwc2, d5vvwc3, d5vvwd2, d5vvwd3, d5vvwe2, d5vvwe3, d5vvwf2, d5vvwf3, d5vvwg2, d5vvwg3, d5vvwh2, d5vvwh3
    automated match to d4hv4a1
    complexed with edo

Details for d5vvwe1

PDB Entry: 5vvw (more details), 2.3 Å

PDB Description: structure of murc from pseudomonas aeruginosa
PDB Compounds: (E:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d5vvwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vvwe1 c.5.1.0 (E:16-103) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
rrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadga
dvlvvssainranpevasalerripvvp

SCOPe Domain Coordinates for d5vvwe1:

Click to download the PDB-style file with coordinates for d5vvwe1.
(The format of our PDB-style files is described here.)

Timeline for d5vvwe1:

  • d5vvwe1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-01