SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vvwc2 (5vvw C:104-319)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137975Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2138030Family c.72.2.0: automated matches [254328] (1 protein)
    not a true family
  6. 2138031Protein automated matches [254749] (2 species)
    not a true protein
  7. 2138032Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271624] (4 PDB entries)
  8. 2291647Domain d5vvwc2: 5vvw C:104-319 [334948]
    Other proteins in same PDB: d5vvwa1, d5vvwa3, d5vvwb1, d5vvwb3, d5vvwc1, d5vvwc3, d5vvwd1, d5vvwd3, d5vvwe1, d5vvwe3, d5vvwf1, d5vvwf3, d5vvwg1, d5vvwg3, d5vvwh1, d5vvwh3
    automated match to d4hv4a2
    complexed with edo

Details for d5vvwc2

PDB Entry: 5vvw (more details), 2.3 Å

PDB Description: structure of murc from pseudomonas aeruginosa
PDB Compounds: (C:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d5vvwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vvwc2 c.72.2.0 (C:104-319) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
raemlaelmryrhgiavagthgkttttsliasvfaaggldptfviggrlnaagtnaqlga
srylvaeadesdasflhlqpmvavvtnidadhmatyggdfnklkktfveflhnlpfygla
vmcvddpvvreilpqiarptvtyglsedadvrainirqegmrtwftvlrperepldvsvn
mpglhnvlnslativiatdegisdeaivqglsgfqg

SCOPe Domain Coordinates for d5vvwc2:

Click to download the PDB-style file with coordinates for d5vvwc2.
(The format of our PDB-style files is described here.)

Timeline for d5vvwc2:

  • d5vvwc2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-01