Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) |
Family c.5.1.0: automated matches [254240] (1 protein) not a true family |
Protein automated matches [254548] (5 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [334946] (1 PDB entry) |
Domain d5vvwc1: 5vvw C:16-103 [334947] Other proteins in same PDB: d5vvwa2, d5vvwa3, d5vvwb2, d5vvwb3, d5vvwc2, d5vvwc3, d5vvwd2, d5vvwd3, d5vvwe2, d5vvwe3, d5vvwf2, d5vvwf3, d5vvwg2, d5vvwg3, d5vvwh2, d5vvwh3 automated match to d4hv4a1 complexed with edo |
PDB Entry: 5vvw (more details), 2.3 Å
SCOPe Domain Sequences for d5vvwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vvwc1 c.5.1.0 (C:16-103) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} rrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadga dvlvvssainranpevasalerripvvp
Timeline for d5vvwc1: