SCOPe 2.08: Domain d5l6qb_: 5l6q B:

Lineage for d5l6qb_ (5l6q B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5l6qb_: 5l6q B: [334927]
   automated match to d1igml_
   complexed with cl, co3, na, peg, pge, zn

Details for d5l6qb_

PDB Entry: 5l6q, 1.4 Å

PDB Description: refolded al protein from cardiac amyloidosis

PDB Compounds: (B:) h5al

SCOPe Domain Sequences for d5l6qb_:

Sequence; same for both SEQRES and ATOM records:

>d5l6qb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seltqdpavsvalgqtvritcqgdslrsysaswyqqkpgqapvlvifrksnrpsgipdrf
sgsssgntasltitgaqaedeadyycnsrdssanhqvfgggtkltvlg

Timeline for d5l6qb_:

• d5l6qb_ first appeared in SCOPe 2.06
  
• d5l6qb_ appears in SCOPe 2.07