Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein automated matches [190916] (13 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [334912] (1 PDB entry) |
Domain d5u9md2: 5u9m D:74-241 [334920] Other proteins in same PDB: d5u9ma_, d5u9mb1, d5u9mc_, d5u9md1 automated match to d1jk9b1 complexed with zn |
PDB Entry: 5u9m (more details), 2.35 Å
SCOPe Domain Sequences for d5u9md2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u9md2 b.1.8.1 (D:74-241) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeagnyhasi hekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqligrsfvis kslnhpenepssvkdysflgviarsagvwennkqvcactgktvwaaak
Timeline for d5u9md2:
View in 3D Domains from other chains: (mouse over for more information) d5u9ma_, d5u9mb1, d5u9mb2, d5u9mc_ |