Lineage for d5u9md2 (5u9m D:74-241)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2764372Protein automated matches [190916] (13 species)
    not a true protein
  7. 2764376Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [334912] (1 PDB entry)
  8. 2764378Domain d5u9md2: 5u9m D:74-241 [334920]
    Other proteins in same PDB: d5u9ma_, d5u9mb1, d5u9mc_, d5u9md1
    automated match to d1jk9b1
    complexed with zn

Details for d5u9md2

PDB Entry: 5u9m (more details), 2.35 Å

PDB Description: copper-zinc superoxide dismutase is activated through a sulfenic acid intermediate at a copper-ion entry site
PDB Compounds: (D:) superoxide dismutase 1 copper chaperone

SCOPe Domain Sequences for d5u9md2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u9md2 b.1.8.1 (D:74-241) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeagnyhasi
hekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqligrsfvis
kslnhpenepssvkdysflgviarsagvwennkqvcactgktvwaaak

SCOPe Domain Coordinates for d5u9md2:

Click to download the PDB-style file with coordinates for d5u9md2.
(The format of our PDB-style files is described here.)

Timeline for d5u9md2: