SCOPe 2.06: Domain d5u9mb2: 5u9m B:74-241

Lineage for d5u9mb2 (5u9m B:74-241)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein automated matches [190916] (10 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:559292] [334912] (1 PDB entry)

8. Domain d5u9mb2: 5u9m B:74-241 [334913]
   Other proteins in same PDB: d5u9ma_, d5u9mb1, d5u9mc_, d5u9md1
   automated match to d1jk9b1
   complexed with zn

Details for d5u9mb2

PDB Entry: 5u9m, 2.35 Å

PDB Description: copper-zinc superoxide dismutase is activated through a sulfenic acid intermediate at a copper-ion entry site

PDB Compounds: (B:) superoxide dismutase 1 copper chaperone

SCOPe Domain Sequences for d5u9mb2:

Sequence; same for both SEQRES and ATOM records:

>d5u9mb2 b.1.8.1 (B:74-241) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
gkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeagnyhasi
hekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqligrsfvis
kslnhpenepssvkdysflgviarsagvwennkqvcactgktvwaaak

Timeline for d5u9mb2:

• d5u9mb2 is new in SCOPe 2.06-stable
  
• d5u9mb2 appears in SCOPe 2.07
  
• d5u9mb2 appears in the current release, SCOPe 2.08