Lineage for d5l6qa_ (5l6q A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754410Domain d5l6qa_: 5l6q A: [334893]
    automated match to d1igml_
    complexed with cl, co3, na, peg, pge, zn

Details for d5l6qa_

PDB Entry: 5l6q (more details), 1.4 Å

PDB Description: refolded al protein from cardiac amyloidosis
PDB Compounds: (A:) h5al

SCOPe Domain Sequences for d5l6qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l6qa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seltqdpavsvalgqtvritcqgdslrsysaswyqqkpgqapvlvifrksnrpsgipdrf
sgsssgntasltitgaqaedeadyycnsrdssanhqvfgggtkltvlg

SCOPe Domain Coordinates for d5l6qa_:

Click to download the PDB-style file with coordinates for d5l6qa_.
(The format of our PDB-style files is described here.)

Timeline for d5l6qa_: