Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (10 species) not a true protein |
Species Candida albicans [TaxId:5476] [334873] (4 PDB entries) |
Domain d5n13a1: 5n13 A:386-490 [334890] Other proteins in same PDB: d5n13a2 automated match to d2dwwa_ complexed with gol |
PDB Entry: 5n13 (more details), 1.2 Å
SCOPe Domain Sequences for d5n13a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n13a1 a.29.2.0 (A:386-490) automated matches {Candida albicans [TaxId: 5476]} aaelrfcnqtikelmskkhynynfpflapvdtvalnipnyneivkqpmdlgtiqsklann eyenaddfekdvrlvfkncylfnpegtdvnmmghrleavfdkkwa
Timeline for d5n13a1: