Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
Protein automated matches [191112] (14 species) not a true protein |
Species Myxococcus xanthus [TaxId:246197] [334864] (8 PDB entries) |
Domain d5mzzb_: 5mzz B: [334879] automated match to d1poib_ complexed with 8ew, act, gol |
PDB Entry: 5mzz (more details), 2.3 Å
SCOPe Domain Sequences for d5mzzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mzzb_ c.124.1.0 (B:) automated matches {Myxococcus xanthus [TaxId: 246197]} ditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylacvgsldpeip tllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmtasgsldkp rtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisdlgvfelg asgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphgyrdalvg a
Timeline for d5mzzb_: