Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (14 species) not a true protein |
Species Yeast (Candida albicans) [TaxId:5476] [334873] (4 PDB entries) |
Domain d5n16d1: 5n16 D:193-320 [334876] Other proteins in same PDB: d5n16a2, d5n16b2, d5n16c2, d5n16d2 automated match to d5feaa_ complexed with 8fn, gol, ni |
PDB Entry: 5n16 (more details), 1.76 Å
SCOPe Domain Sequences for d5n16d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n16d1 a.29.2.0 (D:193-320) automated matches {Yeast (Candida albicans) [TaxId: 5476]} apkppqepdmnnlpenpipqhqakfvlntikavkrnreavpflhpvdtvklnvpfyynyi prpmdlstierkinlkayedvsqvvddfnlmvknckkfngeaagiskmatniqaqfeklm vkvppkel
Timeline for d5n16d1: