SCOPe 2.07: Domain d5n16d1: 5n16 D:193-320

Lineage for d5n16d1 (5n16 D:193-320)

Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds)
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topology
Superfamily a.29.2: Bromodomain [47370] (2 families)
Family a.29.2.0: automated matches [191428] (1 protein)
not a true family
Protein automated matches [190615] (14 species)
not a true protein
Species Yeast (Candida albicans) [TaxId:5476] [334873] (4 PDB entries)
Domain d5n16d1: 5n16 D:193-320 [334876]
Other proteins in same PDB: d5n16a2, d5n16b2, d5n16c2, d5n16d2
automated match to d5feaa_
complexed with 8fn, gol, ni

Details for d5n16d1

PDB Entry: 5n16 (more details), 1.76 Å

PDB Description: first bromodomain (bd1) from candida albicans bdf1 bound to a dibenzothiazepinone (compound 1)

PDB Compounds: (D:) Bromodomain-containing factor 1

SCOPe Domain Sequences for d5n16d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n16d1 a.29.2.0 (D:193-320) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
apkppqepdmnnlpenpipqhqakfvlntikavkrnreavpflhpvdtvklnvpfyynyi
prpmdlstierkinlkayedvsqvvddfnlmvknckkfngeaagiskmatniqaqfeklm
vkvppkel

SCOPe Domain Coordinates for d5n16d1:

Click to download the PDB-style file with coordinates for d5n16d1.
(The format of our PDB-style files is described here.)

Timeline for d5n16d1: