Lineage for d5mnje_ (5mnj E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939164Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (31 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 2939192Domain d5mnje_: 5mnj E: [334870]
    Other proteins in same PDB: d5mnjb_, d5mnjf_
    automated match to d2clwa_
    complexed with so4, zn

Details for d5mnje_

PDB Entry: 5mnj (more details), 2.16 Å

PDB Description: structure of mdm2-mdmx-ubch5b-ubiquitin complex
PDB Compounds: (E:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d5mnje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mnje_ d.20.1.1 (E:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
alkrihkelndlardppaqcragpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsikldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d5mnje_:

Click to download the PDB-style file with coordinates for d5mnje_.
(The format of our PDB-style files is described here.)

Timeline for d5mnje_: