SCOPe 2.08: Domain d5k74b_: 5k74 B:

Lineage for d5k74b_ (5k74 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)

8. Domain d5k74b_: 5k74 B: [334834]
   automated match to d3l0la_
   complexed with 6qw

Details for d5k74b_

PDB Entry: 5k74, 2.75 Å

PDB Description: crystal structure of retinoic acid receptor-related orphan receptor (ror) gamma ligand binding domain complex with sbi0655870

PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5k74b_:

Sequence; same for both SEQRES and ATOM records:

>d5k74b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhp

Timeline for d5k74b_:

• d5k74b_ first appeared in SCOPe 2.06
  
• d5k74b_ appears in SCOPe 2.07