SCOPe 2.06: Domain d5k38b_: 5k38 B:

Lineage for d5k38b_ (5k38 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (54 PDB entries)

8. Domain d5k38b_: 5k38 B: [334826]
   automated match to d3l0la_

Details for d5k38b_

PDB Entry: 5k38, 2.05 Å

PDB Description: crystal structure of retinoic acid receptor-related orphan receptor (ror) gamma ligand binding domain

PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5k38b_:

Sequence; same for both SEQRES and ATOM records:

>d5k38b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlh

Timeline for d5k38b_:

• d5k38b_ is new in SCOPe 2.06-stable
  
• d5k38b_ appears in SCOPe 2.07
  
• d5k38b_ appears in the current release, SCOPe 2.08