Lineage for d5vjka_ (5vjk A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776533Species Influenza A virus [TaxId:1332244] [228093] (27 PDB entries)
  8. 2776558Domain d5vjka_: 5vjk A: [334775]
    Other proteins in same PDB: d5vjkb_
    automated match to d4d00c_
    complexed with nag; mutant

Details for d5vjka_

PDB Entry: 5vjk (more details), 2.59 Å

PDB Description: crystal structure of h7 hemagglutinin mutant (v186k, k193t, g228s) from the influenza virus a/shanghai/2/2013 (h7n9)
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d5vjka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vjka_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 1332244]}
kiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtit
gppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgir
tngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhskstae
qttlygsgnklvtvgssnyqqsfvpspgarpqvnglssridfhwlmlnpndtvtfsfnga
fiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvk
qrslllatgmknvpe

SCOPe Domain Coordinates for d5vjka_:

Click to download the PDB-style file with coordinates for d5vjka_.
(The format of our PDB-style files is described here.)

Timeline for d5vjka_: