Lineage for d1hkca2 (1hkc A:223-465)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25008Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) (S)
  5. 25108Family c.55.1.3: Hexokinase [53083] (2 proteins)
  6. 25113Protein Mammalian type I hexokinase [53086] (2 species)
  7. 25114Species Human (Homo sapiens) [TaxId:9606] [53087] (5 PDB entries)
  8. 25128Domain d1hkca2: 1hkc A:223-465 [33476]

Details for d1hkca2

PDB Entry: 1hkc (more details), 2.8 Å

PDB Description: recombinant human hexokinase type i complexed with glucose and phosphate

SCOP Domain Sequences for d1hkca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkca2 c.55.1.3 (A:223-465) Mammalian type I hexokinase {Human (Homo sapiens)}
hcevgliigtgtnacymeelrhidlvegdegrmcintewgafgddgsledirtefdreid
rgslnpgkqlfekmvsgmylgelvrlilvkmakegllfegritpelltrgkfntsdvsai
eknkeglhnakeiltrlgvepsdddcvsvqhvctivsfrsanlvaatlgailnrlrdnkg
tprlrttvgvdgslykthpqysrrfhktlrrlvpdsdvrfllsesgsgkgaamvtavayr
lae

SCOP Domain Coordinates for d1hkca2:

Click to download the PDB-style file with coordinates for d1hkca2.
(The format of our PDB-style files is described here.)

Timeline for d1hkca2: