Lineage for d5vk4b2 (5vk4 B:169-344)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978140Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2978141Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2978221Family d.139.1.0: automated matches [227182] (1 protein)
    not a true family
  6. 2978222Protein automated matches [226902] (12 species)
    not a true protein
  7. 2978251Species Neisseria gonorrhoeae [TaxId:485] [334375] (1 PDB entry)
  8. 2978253Domain d5vk4b2: 5vk4 B:169-344 [334723]
    Other proteins in same PDB: d5vk4a1, d5vk4b1
    automated match to d3p4ea2
    complexed with anp, mg

Details for d5vk4b2

PDB Entry: 5vk4 (more details), 2.65 Å

PDB Description: crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium
PDB Compounds: (B:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d5vk4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vk4b2 d.139.1.0 (B:169-344) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
tglsvgagdmvlglasngahsngyslirkiierdnpdldaefdngktlreaviaptrlyv
kpilaalekftikgmahitgggitenvprvlpkntvaqidaeswelpklfqwlqkagnve
tqemyrtfncgigmvvivaaedadavrsflsgqgetvyrlgcirerqgnehqtqva

SCOPe Domain Coordinates for d5vk4b2:

Click to download the PDB-style file with coordinates for d5vk4b2.
(The format of our PDB-style files is described here.)

Timeline for d5vk4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vk4b1