SCOPe 2.08: Domain d5v69a2: 5v69 A:1543-1802

Lineage for d5v69a2 (5v69 A:1543-1802)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein Papain-like protease PLpro, catalytic domain [310795] (4 species)

7. Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311055] (7 PDB entries)

8. Domain d5v69a2: 5v69 A:1543-1802 [334684]
   Other proteins in same PDB: d5v69a1, d5v69b_
   automated match to d4pt5a2
   complexed with cl, na, pgo, zn

Details for d5v69a2

PDB Entry: 5v69, 2.55 Å

PDB Description: crystal structure of the middle east respiratory syndrome coronavirus papain-like protease bound to ubiquitin variant me.4

PDB Compounds: (A:) MERS-CoV PLpro

SCOPe Domain Sequences for d5v69a2:

Sequence; same for both SEQRES and ATOM records:

>d5v69a2 d.3.1.23 (A:1543-1802) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyssdc

Timeline for d5v69a2:

• d5v69a2 first appeared in SCOPe 2.06
  
• d5v69a2 appears in SCOPe 2.07