Lineage for d5v69a1 (5v69 A:1481-1542)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178713Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2178714Protein automated matches [190233] (22 species)
    not a true protein
  7. 2178895Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311415] (4 PDB entries)
  8. 2178898Domain d5v69a1: 5v69 A:1481-1542 [334683]
    Other proteins in same PDB: d5v69a2, d5v69b_
    automated match to d4pt5a1
    complexed with cl, na, pgo, zn

Details for d5v69a1

PDB Entry: 5v69 (more details), 2.55 Å

PDB Description: crystal structure of the middle east respiratory syndrome coronavirus papain-like protease bound to ubiquitin variant me.4
PDB Compounds: (A:) MERS-CoV PLpro

SCOPe Domain Sequences for d5v69a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v69a1 d.15.1.0 (A:1481-1542) automated matches {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
qqltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladn
lt

SCOPe Domain Coordinates for d5v69a1:

Click to download the PDB-style file with coordinates for d5v69a1.
(The format of our PDB-style files is described here.)

Timeline for d5v69a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5v69a2
View in 3D
Domains from other chains:
(mouse over for more information)
d5v69b_