SCOPe 2.06: Domain d5u52z_: 5u52 Z:

Lineage for d5u52z_ (5u52 Z:)

1. Root: SCOPe 2.06

2. Class k: Designed proteins [58788] (44 folds)

3. Fold k.13: Protein A Ig(Fc)-binding domain mimics [58863] (1 superfamily)

4. Superfamily k.13.1: Protein A Ig(Fc)-binding domain mimics [58864] (1 family)

5. Family k.13.1.1: Protein A Ig(Fc)-binding domain mimics [58865] (1 protein)

6. Protein Protein A Ig(Fc)-binding domain mimics [58866] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [334652] (1 PDB entry)

8. Domain d5u52z_: 5u52 Z: [334680]
   automated match to d1l6xb_
   complexed with fuc, gal, man, nag

Details for d5u52z_

PDB Entry: 5u52, 1.94 Å

PDB Description: 2 helix minimized version of the b-domain from protein a (z34c0 bound to igg1 fc (monoclinic form)

PDB Compounds: (Z:) Mini Z domain

SCOPe Domain Sequences for d5u52z_:

Sequence; same for both SEQRES and ATOM records:

>d5u52z_ k.13.1.1 (Z:) Protein A Ig(Fc)-binding domain mimics {Staphylococcus aureus [TaxId: 1280]}
fnmqcqrrfyealhdpnlneeqrnakiksirddc

Timeline for d5u52z_:

• d5u52z_ is new in SCOPe 2.06-stable
  
• d5u52z_ appears in the current release, SCOPe 2.07