Lineage for d1qhaa2 (1qha A:223-465)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492087Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 2492109Protein Mammalian type I hexokinase [53086] (2 species)
    further duplication: consists of two very similar lobes
  7. 2492110Species Human (Homo sapiens) [TaxId:9606] [53087] (10 PDB entries)
  8. 2492116Domain d1qhaa2: 1qha A:223-465 [33468]
    complexed with anp, g6p, glc, mg

Details for d1qhaa2

PDB Entry: 1qha (more details), 2.25 Å

PDB Description: human hexokinase type i complexed with atp analogue amp-pnp
PDB Compounds: (A:) protein (hexokinase)

SCOPe Domain Sequences for d1qhaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhaa2 c.55.1.3 (A:223-465) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}
hcevgliigtgtnacymeelrhidlvegdegrmcintewgafgddgsledirtefdreid
rgslnpgkqlfekmvsgmylgelvrlilvkmakegllfegritpelltrgkfntsdvsai
eknkeglhnakeiltrlgvepsdddcvsvqhvctivsfrsanlvaatlgailnrlrdnkg
tprlrttvgvdgslykthpqysrrfhktlrrlvpdsdvrfllsesgsgkgaamvtavayr
lae

SCOPe Domain Coordinates for d1qhaa2:

Click to download the PDB-style file with coordinates for d1qhaa2.
(The format of our PDB-style files is described here.)

Timeline for d1qhaa2: