Lineage for d1qhaa2 (1qha A:223-465)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 71789Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 71904Family c.55.1.3: Hexokinase [53083] (2 proteins)
  6. 71911Protein Mammalian type I hexokinase [53086] (2 species)
  7. 71912Species Human (Homo sapiens) [TaxId:9606] [53087] (5 PDB entries)
  8. 71918Domain d1qhaa2: 1qha A:223-465 [33468]

Details for d1qhaa2

PDB Entry: 1qha (more details), 2.25 Å

PDB Description: human hexokinase type i complexed with atp analogue amp-pnp

SCOP Domain Sequences for d1qhaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhaa2 c.55.1.3 (A:223-465) Mammalian type I hexokinase {Human (Homo sapiens)}
hcevgliigtgtnacymeelrhidlvegdegrmcintewgafgddgsledirtefdreid
rgslnpgkqlfekmvsgmylgelvrlilvkmakegllfegritpelltrgkfntsdvsai
eknkeglhnakeiltrlgvepsdddcvsvqhvctivsfrsanlvaatlgailnrlrdnkg
tprlrttvgvdgslykthpqysrrfhktlrrlvpdsdvrfllsesgsgkgaamvtavayr
lae

SCOP Domain Coordinates for d1qhaa2:

Click to download the PDB-style file with coordinates for d1qhaa2.
(The format of our PDB-style files is described here.)

Timeline for d1qhaa2: