SCOPe 2.06: Domain d5vg0a_: 5vg0 A:

Lineage for d5vg0a_ (5vg0 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Jonesia denitrificans [TaxId:471856] [334644] (2 PDB entries)

8. Domain d5vg0a_: 5vg0 A: [334679]
   automated match to d5aa7a_
   complexed with cu, per

Details for d5vg0a_

PDB Entry: 5vg0, 1.1 Å

PDB Description: room temperature x-ray crystallographic structure of a jonesia denitrificans lytic polysaccharide monooxygenase at 1.1 angstrom resolution.

PDB Compounds: (A:) chitinase

SCOPe Domain Sequences for d5vg0a_:

Sequence; same for both SEQRES and ATOM records:

>d5vg0a_ b.1.18.0 (A:) automated matches {Jonesia denitrificans [TaxId: 471856]}
hgwvtdppsrqalcasgetsfdcgqisyepqsveapkgattcsggneafailddnskpwp
tteiastvdltwkltaphntstweyfvdgqlhqtfdqkgqqpptslthtltdlptgehti
larwnvsntnnafyncmdvvvs

Timeline for d5vg0a_:

• d5vg0a_ is new in SCOPe 2.06-stable
  
• d5vg0a_ appears in SCOPe 2.07
  
• d5vg0a_ appears in the current release, SCOPe 2.08