Lineage for d1czan2 (1cza N:223-465)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) 
Family c.55.1.3: Hexokinase [53083] (2 proteins) Protein Mammalian type I hexokinase [53086] (2 species) Species Human (Homo sapiens) [TaxId:9606] [53087] (5 PDB entries) 
Domain d1czan2: 1cza N:223-465 [33464]
Details for d1czan2
PDB Entry: 1cza (more details), 1.9 Å
PDB Description: mutant monomer of recombinant human hexokinase type i complexed with glucose, glucose-6-phosphate, and adp
SCOP Domain Sequences for d1czan2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czan2 c.55.1.3 (N:223-465) Mammalian type I hexokinase {Human (Homo sapiens)}
hcevgliigtgtnacymeelrhidlvegdegrmcintewgafgddgsledirtefdraid
ayslnpgkqlfekmvsgmylgelvrlilvkmakegllfegritpelltrgkfntsdvsai
eknkeglhnakeiltrlgvepsdddcvsvqhvctivsfrsanlvaatlgailnrlrdnkg
tprlrttvgvdgslykthpqysrrfhktlrrlvpdsdvrfllsesgsgkgaamvtavayr
lae
SCOP Domain Coordinates for d1czan2:
Click to download the PDB-style file with coordinates for d1czan2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1czan2:
- d1czan2 appears in SCOP 1.57
- d1czan2 appears in the current release, SCOPe 2.08
View in 3D
