Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
Superfamily d.126.1: Pentein [55909] (8 families) |
Family d.126.1.5: Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111152] (1 protein) # functionally related to the amidinotransferase, similar active sites automatically mapped to Pfam PF03068 |
Protein Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111153] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111154] (17 PDB entries) Uniprot Q9UM07 |
Domain d5n0ma3: 5n0m A:294-663 [334593] Other proteins in same PDB: d5n0ma1, d5n0ma2 automated match to d1wd8a3 complexed with 8ht, ca, so4 |
PDB Entry: 5n0m (more details), 2.18 Å
SCOPe Domain Sequences for d5n0ma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n0ma3 d.126.1.5 (A:294-663) Peptidylarginine deiminase Pad4, catalytic C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} apwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdeme igyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlevs ppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghvd eflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsnk tlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvlg khlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhcgtnvrrkp fsfkwwnmvp
Timeline for d5n0ma3: