Lineage for d5mluc_ (5mlu C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2698678Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (11 PDB entries)
  8. 2698689Domain d5mluc_: 5mlu C: [334549]
    automated match to d3lelg_
    protein/DNA complex; complexed with mn

Details for d5mluc_

PDB Entry: 5mlu (more details), 2.8 Å

PDB Description: crystal structure of the pfv gag cbs bound to a mononucleosome
PDB Compounds: (C:) Histone H2A type 1

SCOPe Domain Sequences for d5mluc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mluc_ a.22.1.1 (C:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
trssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnkk
triiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

SCOPe Domain Coordinates for d5mluc_:

Click to download the PDB-style file with coordinates for d5mluc_.
(The format of our PDB-style files is described here.)

Timeline for d5mluc_: