SCOP 1.71: Domain d1e4ft1: 1e4f T:7-199

Lineage for d1e4ft1 (1e4f T:7-199)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Cell division protein FtsA [53078] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [53079] (2 PDB entries)

8. Domain d1e4ft1: 1e4f T:7-199 [33453]

Details for d1e4ft1

PDB Entry: 1e4f, 1.9 Å

PDB Description: ftsa (apo form) from thermotoga maritima

SCOP Domain Sequences for d1e4ft1:

Sequence; same for both SEQRES and ATOM records:

>d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima}
tvfytsidigsryikglvlgkrdqewealafssvksrgldegeikdaiafkesvntllke
leeqlqkslrsdfvisfssvsferedtvierdfgeekrsitldilsemqsealeklkeng
ktplhifskrylldderivfnpldmkaskiaieytsivvplkvyemfynflqdtvkspfq
lksslvstaegvl

Timeline for d1e4ft1:

• d1e4ft1 first appeared (with stable ids) in SCOP 1.55
  
• d1e4ft1 appears in SCOP 1.69
  
• d1e4ft1 appears in SCOP 1.73
  
• d1e4ft1 appears in the current release, SCOPe 2.08