Lineage for d1e4ft1 (1e4f T:7-199)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this foldFamily c.55.1.1: Actin/HSP70 [53068] (8 proteins) 
Protein Cell division protein FtsA [53078] (1 species) Species Thermotoga maritima [TaxId:2336] [53079] (3 PDB entries) 
Domain d1e4ft1: 1e4f T:7-199 [33453]
CASP4
Details for d1e4ft1
PDB Entry: 1e4f (more details), 1.9 Å
PDB Description: ftsa (apo form) from thermotoga maritima
PDB Compounds: (T:) cell division protein ftsaSCOPe Domain Sequences for d1e4ft1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]}
tvfytsidigsryikglvlgkrdqewealafssvksrgldegeikdaiafkesvntllke
leeqlqkslrsdfvisfssvsferedtvierdfgeekrsitldilsemqsealeklkeng
ktplhifskrylldderivfnpldmkaskiaieytsivvplkvyemfynflqdtvkspfq
lksslvstaegvl
SCOPe Domain Coordinates for d1e4ft1:
Click to download the PDB-style file with coordinates for d1e4ft1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e4ft1:
- d1e4ft1 first appeared (with stable ids) in SCOP 1.55
- d1e4ft1 appears in SCOPe 2.07
View in 3D
