SCOPe 2.06: Domain d5g5xb1: 5g5x B:1-116

Lineage for d5g5xb1 (5g5x B:1-116)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)

8. Domain d5g5xb1: 5g5x B:1-116 [334527]
   Other proteins in same PDB: d5g5xb2
   automated match to d4zg1a_
   complexed with amp, atp

Details for d5g5xb1

PDB Entry: 5g5x, 2.8 Å

PDB Description: cbs domain tandem of site-2 protease from archaeoglobus fulgidus in complex with llama nanobody - nucleotide-bound form

PDB Compounds: (B:) Nanobody

SCOPe Domain Sequences for d5g5xb1:

Sequence; same for both SEQRES and ATOM records:

>d5g5xb1 b.1.1.1 (B:1-116) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgsgfnnnamgwyrqapgkqrelvaaitsfgstnya
dsvkgrftisrdnakntvylqmnslkpedtavyyctagwgatprsywgqgtqvtvs

Timeline for d5g5xb1:

• d5g5xb1 is new in SCOPe 2.06-stable
  
• d5g5xb1 appears in SCOPe 2.07
  
• d5g5xb1 appears in the current release, SCOPe 2.08