SCOP 1.69: Domain d1yvna1: 1yvn A:4-146

Lineage for d1yvna1 (1yvn A:4-146)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53077] (2 PDB entries)

8. Domain d1yvna1: 1yvn A:4-146 [33451]
   Other proteins in same PDB: d1yvng_

Details for d1yvna1

PDB Entry: 1yvn, 2.1 Å

PDB Description: the yeast actin val 159 asn mutant complex with human gelsolin segment 1.

SCOP Domain Sequences for d1yvna1:

Sequence; same for both SEQRES and ATOM records:

>d1yvna1 c.55.1.1 (A:4-146) Actin {Baker's yeast (Saccharomyces cerevisiae)}
evaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqskrg
iltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqim
fetfnvpafyvsiqavlslyssg

Timeline for d1yvna1:

• d1yvna1 first appeared (with stable ids) in SCOP 1.55
  
• d1yvna1 appears in SCOP 1.67
  
• d1yvna1 appears in SCOP 1.71
  
• d1yvna1 appears in the current release, SCOPe 2.08