Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
Protein Actin [53073] (6 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53077] (2 PDB entries) |
Domain d1yvna1: 1yvn A:4-146 [33451] Other proteins in same PDB: d1yvng_ |
PDB Entry: 1yvn (more details), 2.1 Å
SCOP Domain Sequences for d1yvna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvna1 c.55.1.1 (A:4-146) Actin {Baker's yeast (Saccharomyces cerevisiae)} evaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqskrg iltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqim fetfnvpafyvsiqavlslyssg
Timeline for d1yvna1: