Lineage for d1yvna1 (1yvn A:4-146)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 245988Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 245989Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 245990Protein Actin [53073] (6 species)
  7. 245991Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53077] (2 PDB entries)
  8. 245994Domain d1yvna1: 1yvn A:4-146 [33451]
    Other proteins in same PDB: d1yvng_

Details for d1yvna1

PDB Entry: 1yvn (more details), 2.1 Å

PDB Description: the yeast actin val 159 asn mutant complex with human gelsolin segment 1.

SCOP Domain Sequences for d1yvna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvna1 c.55.1.1 (A:4-146) Actin {Baker's yeast (Saccharomyces cerevisiae)}
evaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqskrg
iltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqim
fetfnvpafyvsiqavlslyssg

SCOP Domain Coordinates for d1yvna1:

Click to download the PDB-style file with coordinates for d1yvna1.
(The format of our PDB-style files is described here.)

Timeline for d1yvna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yvna2
View in 3D
Domains from other chains:
(mouse over for more information)
d1yvng_