Lineage for d5lu4a3 (5lu4 A:516-872)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2423593Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2423950Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2423951Protein automated matches [190614] (15 species)
    not a true protein
  7. 2424016Species Flaveria trinervia [TaxId:4227] [332556] (3 PDB entries)
  8. 2424017Domain d5lu4a3: 5lu4 A:516-872 [334490]
    Other proteins in same PDB: d5lu4a1, d5lu4a2, d5lu4b1, d5lu4b2
    automated match to d1vbga1
    complexed with adp, mg, pyr

Details for d5lu4a3

PDB Entry: 5lu4 (more details), 2.9 Å

PDB Description: c4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism
PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5lu4a3:

Sequence, based on SEQRES records: (download)

>d5lu4a3 c.1.12.0 (A:516-872) automated matches {Flaveria trinervia [TaxId: 4227]}
pamsndleifmswadqarrlkvmanadtpndaltarnngaqgiglcrtehmffasderik
avrkmimavtpeqrkvaldlllpyqrsdfegiframdglpvtirlldpplheflpegdle
hivnelavdtgmsadeiyskienlsevnpmlgfrgcrlgisypeltemqvraifqaavsm
tnqgvtvipeimvplvgtpqelrhqisvirgvaanvfaemgvtleykvgtmieipraali
aeeigkeadffsfgtndltqmtfgysrddvgkflqiylaqgilqhdpfevidqkgvgqli
kmatekgraanpslkvgicgehggepssvaffdgvgldyvscspfrvpiarlaaaqv

Sequence, based on observed residues (ATOM records): (download)

>d5lu4a3 c.1.12.0 (A:516-872) automated matches {Flaveria trinervia [TaxId: 4227]}
pamsndleifmswadqarrlkvmanadtpndaltarnngaqgiglcrtehmffasderik
avrkmimavtpeqrkvaldlllpyqrsdfegiframdglpvtirlldpplhefliyskie
nlsevnpmlgfrgcrlgisypeltemqvraifqaavsmtnqgvtvipeimvplvgtpqel
rhqisvirgvaanvfaemgvtleykvgtmieipraaliaeeigkeadffsfgtndltqmt
fgysrddvgkflqiylaqgilqhdpfevidqkgvgqlikmatekgraanpslkvgicgeh
ggepssvaffdgvgldyvscspfrvpiarlaaaqv

SCOPe Domain Coordinates for d5lu4a3:

Click to download the PDB-style file with coordinates for d5lu4a3.
(The format of our PDB-style files is described here.)

Timeline for d5lu4a3: