Lineage for d1yaga1 (1yag A:4-146)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488063Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) (S)
    duplication contains two domains of this fold
  5. 488064Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 488065Protein Actin [53073] (6 species)
  7. 488066Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53077] (2 PDB entries)
  8. 488067Domain d1yaga1: 1yag A:4-146 [33449]
    Other proteins in same PDB: d1yagg_

Details for d1yaga1

PDB Entry: 1yag (more details), 1.9 Å

PDB Description: structure of the yeast actin-human gelsolin segment 1 complex

SCOP Domain Sequences for d1yaga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yaga1 c.55.1.1 (A:4-146) Actin {Baker's yeast (Saccharomyces cerevisiae)}
evaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqskrg
iltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqim
fetfnvpafyvsiqavlslyssg

SCOP Domain Coordinates for d1yaga1:

Click to download the PDB-style file with coordinates for d1yaga1.
(The format of our PDB-style files is described here.)

Timeline for d1yaga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yaga2
View in 3D
Domains from other chains:
(mouse over for more information)
d1yagg_