Lineage for d5lu4a1 (5lu4 A:1-380)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217671Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2217672Protein automated matches [226904] (32 species)
    not a true protein
  7. 2217722Species Flaveria trinervia [TaxId:4227] [332552] (3 PDB entries)
  8. 2217723Domain d5lu4a1: 5lu4 A:1-380 [334488]
    Other proteins in same PDB: d5lu4a2, d5lu4a3, d5lu4b2, d5lu4b3
    automated match to d1vbga3
    complexed with adp, mg, pyr

Details for d5lu4a1

PDB Entry: 5lu4 (more details), 2.9 Å

PDB Description: c4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism
PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5lu4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lu4a1 d.142.1.0 (A:1-380) automated matches {Flaveria trinervia [TaxId: 4227]}
kkrvftfgkgrsegnrdmksllggkganlaemssiglsvppgltisteaceeyqqngksl
ppglwdeisegldyvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevva
glagksgarfaydsyrrfldmfgnvvmgiphslfdekleqmkaekgihldtdltaadlkd
lvekyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavni
qsmvfgnmgntsgtgvlftrnpstgekklygeflinaqgedvvagirtpedlgtmetcmp
eaykelvenceilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvnegli
dtrtaikrvetqhldqllhp

SCOPe Domain Coordinates for d5lu4a1:

Click to download the PDB-style file with coordinates for d5lu4a1.
(The format of our PDB-style files is described here.)

Timeline for d5lu4a1: