SCOPe 2.08: Domain d5k2jf1: 5k2j F:1-153

Lineage for d5k2jf1 (5k2j F:1-153)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:914127] [334439] (3 PDB entries)

8. Domain d5k2jf1: 5k2j F:1-153 [334484]
   Other proteins in same PDB: d5k2ja2, d5k2jb2, d5k2jc2, d5k2jd2, d5k2je2, d5k2jf2, d5k2jg2, d5k2jh2, d5k2ji2, d5k2jj2, d5k2jk2, d5k2jl2
   automated match to d1tp9a1
   complexed with peo

Details for d5k2jf1

PDB Entry: 5k2j, 1.91 Å

PDB Description: crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus

PDB Compounds: (F:) 1-Cys peroxiredoxin

SCOPe Domain Sequences for d5k2jf1:

Sequence, based on SEQRES records:

>d5k2jf1 c.47.1.0 (F:1-153) automated matches {Vibrio vulnificus [TaxId: 914127]}
miaqgqtlpnatlsqltkegmvhhpvlelfagkkvvlfavpgaftptdseahlpgyivla
dqlkakgvdliasvsvndafvmkawgeaqnaeeilmladgdasftkalglemdtagfggl
rsqryamiidngvvttlnveapksfevsnaeti

Sequence, based on observed residues (ATOM records):

>d5k2jf1 c.47.1.0 (F:1-153) automated matches {Vibrio vulnificus [TaxId: 914127]}
miaqgqtlpnatlsqltgmvhhpvlelfagkkvvlfavpgaftptdseahlpgyivladq
lkakgvdliasvsvndafvmkawgeaqnaeeilmladgdasftkalglemdtagfgglrs
qryamiidngvvttlnveapksfevsnaeti

Timeline for d5k2jf1:

• d5k2jf1 first appeared in SCOPe 2.06
  
• d5k2jf1 appears in SCOPe 2.07