Lineage for d5g5ub1 (5g5u B:1-332)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095808Species Pseudomonas aeruginosa [TaxId:208964] [332878] (7 PDB entries)
  8. 2095816Domain d5g5ub1: 5g5u B:1-332 [334436]
    Other proteins in same PDB: d5g5ua2, d5g5ub2
    automated match to d3gs6a_
    mutant

Details for d5g5ub1

PDB Entry: 5g5u (more details), 2.25 Å

PDB Description: crystal structure of nagz h174a mutant from pseudomonas aeruginosa
PDB Compounds: (B:) Beta-hexosaminidase

SCOPe Domain Sequences for d5g5ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5ub1 c.1.8.0 (B:1-332) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mqgslmldiggtwltaedrqilrhpevggliifarniehpaqvrelcaairairpdllla
vdqeggrvqrlrqgfvrlpamraiadnpnaeelaehcgwlmatevqavgldlsfapvldl
dhqrsavvgsrafegdperaallagafirgmhaagmaatgkhfpghgwaeadsavaiped
arsleeirrsdlvpfarlagqldalmpahviypqvdpqpagfsrrwlqeilrgelkfdgv
ifsddlsmagahvvgdaasrieaalaagcdmglvcndrasaelalaalqrlkvtppsrlq
rmrgkgyantdyrqqprwlealsalraaqlid

SCOPe Domain Coordinates for d5g5ub1:

Click to download the PDB-style file with coordinates for d5g5ub1.
(The format of our PDB-style files is described here.)

Timeline for d5g5ub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5g5ub2