SCOP 1.63: Domain d1c0ga1: 1c0g A:1-146

Lineage for d1c0ga1 (1c0g A:1-146)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (7 PDB entries)

8. Domain d1c0ga1: 1c0g A:1-146 [33443]
   Other proteins in same PDB: d1c0gs_

Details for d1c0ga1

PDB Entry: 1c0g, 2 Å

PDB Description: crystal structure of 1:1 complex between gelsolin segment 1 and a dictyostelium/tetrahymena chimera actin (mutant 228: q228k/t229a/a230y/e360h)

SCOP Domain Sequences for d1c0ga1:

Sequence, based on SEQRES records:

>d1c0ga1 c.55.1.1 (A:1-146) Actin {Slime mold (Dictyostelium discoideum)}
dgedvqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqs
krgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmt
qimfetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d1c0ga1 c.55.1.1 (A:1-146) Actin {Slime mold (Dictyostelium discoideum)}
dgedvqalvidngsgmckagfagddapravfpsivgrprhtgkdsyvgdeaqskrgiltl
kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
ntpamyvaiqavlslyasg

Timeline for d1c0ga1:

• d1c0ga1 first appeared (with stable ids) in SCOP 1.55
  
• d1c0ga1 appears in SCOP 1.61
  
• d1c0ga1 appears in SCOP 1.65
  
• d1c0ga1 appears in the current release, SCOPe 2.08