SCOP 1.63: Domain d1dgaa1: 1dga A:4-146

Lineage for d1dgaa1 (1dga A:4-146)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (7 PDB entries)

8. Domain d1dgaa1: 1dga A:4-146 [33441]
   Other proteins in same PDB: d1dgag_

Details for d1dgaa1

PDB Entry: 1dga, 1.93 Å

PDB Description: structure of dictyostelium discoideum actin complexed with mg atp and human gelsolin segment 1.

SCOP Domain Sequences for d1dgaa1:

Sequence, based on SEQRES records:

>d1dgaa1 c.55.1.1 (A:4-146) Actin {Slime mold (Dictyostelium discoideum)}
dvqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim
fetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d1dgaa1 c.55.1.1 (A:4-146) Actin {Slime mold (Dictyostelium discoideum)}
dvqalvidngsgmckagfagddapravfpsivgrprhtgkdsyvgdeaqskrgiltlkyp
iehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntp
amyvaiqavlslyasg

Timeline for d1dgaa1:

• d1dgaa1 first appeared (with stable ids) in SCOP 1.55
  
• d1dgaa1 appears in SCOP 1.61
  
• d1dgaa1 does not appear in SCOP 1.65