SCOPe 2.08: Domain d5h5gb2: 5h5g B:209-315

Lineage for d5h5gb2 (5h5g B:209-315)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.0: automated matches [227141] (1 protein)
   not a true family

6. Protein automated matches [226843] (9 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282458] [334408] (7 PDB entries)

8. Domain d5h5gb2: 5h5g B:209-315 [334409]
   Other proteins in same PDB: d5h5ga1, d5h5ga3, d5h5gb1, d5h5gb3
   automated match to d4m8ia2
   complexed with ca, gdp

Details for d5h5gb2

PDB Entry: 5h5g, 2.2 Å

PDB Description: staphylococcus aureus ftsz-gdp in t and r states

PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d5h5gb2:

Sequence; same for both SEQRES and ATOM records:

>d5h5gb2 d.79.2.0 (B:209-315) automated matches {Staphylococcus aureus [TaxId: 282458]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

Timeline for d5h5gb2:

• d5h5gb2 first appeared in SCOPe 2.06
  
• d5h5gb2 appears in SCOPe 2.07