Lineage for d5jkkb_ (5jkk B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704097Species Human (Homo sapiens) [TaxId:9606] [255624] (13 PDB entries)
  8. 2704149Domain d5jkkb_: 5jkk B: [334391]
    automated match to d3a9qe_
    complexed with cl, fe, mg

Details for d5jkkb_

PDB Entry: 5jkk (more details), 1.6 Å

PDB Description: crystal structure of the negatively supercharged variant ftn(neg) of human heavy chain ferritin
PDB Compounds: (B:) ferritin heavy chain

SCOPe Domain Sequences for d5jkkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jkkb_ a.25.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseeainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdeddwesglnameealeleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d5jkkb_:

Click to download the PDB-style file with coordinates for d5jkkb_.
(The format of our PDB-style files is described here.)

Timeline for d5jkkb_: