SCOPe 2.08: Domain d5vk4a2: 5vk4 A:169-344

Lineage for d5vk4a2 (5vk4 A:169-344)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.0: automated matches [227182] (1 protein)
   not a true family

6. Protein automated matches [226902] (12 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:485] [334375] (1 PDB entry)

8. Domain d5vk4a2: 5vk4 A:169-344 [334376]
   Other proteins in same PDB: d5vk4a1, d5vk4b1
   automated match to d3p4ea2
   complexed with anp, mg

Details for d5vk4a2

PDB Entry: 5vk4, 2.65 Å

PDB Description: crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium

PDB Compounds: (A:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d5vk4a2:

Sequence; same for both SEQRES and ATOM records:

>d5vk4a2 d.139.1.0 (A:169-344) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
tglsvgagdmvlglasngahsngyslirkiierdnpdldaefdngktlreaviaptrlyv
kpilaalekftikgmahitgggitenvprvlpkntvaqidaeswelpklfqwlqkagnve
tqemyrtfncgigmvvivaaedadavrsflsgqgetvyrlgcirerqgnehqtqva

Timeline for d5vk4a2:

• d5vk4a2 first appeared in SCOPe 2.06
  
• d5vk4a2 appears in SCOPe 2.07