Class a: All alpha proteins [46456] (290 folds) |
Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily) Core: 3 helices; irregular array; disulfide-rich |
Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) automatically mapped to Pfam PF01392 |
Family a.141.1.1: Frizzled cysteine-rich domain [63502] (3 proteins) |
Protein automated matches [334321] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [334322] (3 PDB entries) |
Domain d5uryb_: 5ury B: [334329] automated match to d1ijya_ complexed with pam |
PDB Entry: 5ury (more details), 2.1 Å
SCOPe Domain Sequences for d5uryb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uryb_ a.141.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvcqeitvpmcrgigynlthmpnqfnhdtqdeaglevhqfwplveiqcspdlrfflcsmy tpiclpdyhkplppcrsvcerakagcsplmrqygfawpermscdrlpvlgrdaevlcmdy e
Timeline for d5uryb_: