SCOPe 2.06: Domain d5v4ka_: 5v4k A:

Lineage for d5v4ka_ (5v4k A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein automated matches [190358] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187279] (26 PDB entries)

8. Domain d5v4ka_: 5v4k A: [334315]
   automated match to d3waoa_
   complexed with gol, so4

Details for d5v4ka_

PDB Entry: 5v4k, 2.1 Å

PDB Description: crystal structure of nedd4 lir-fused human lc3b_2-119

PDB Compounds: (A:) Microtubule-associated proteins 1A/1B light chain 3B,Microtubule-associated proteins 1A/1B light chain 3B,Microtubule-associated proteins 1A/1B light chain 3B

SCOPe Domain Sequences for d5v4ka_:

Sequence; same for both SEQRES and ATOM records:

>d5v4ka_ d.15.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enweiigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkfl
vpdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvy
asqet

Timeline for d5v4ka_:

• d5v4ka_ is new in SCOPe 2.06-stable
  
• d5v4ka_ appears in SCOPe 2.07
  
• d5v4ka_ appears in the current release, SCOPe 2.08