Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
Protein Actin [53073] (6 species) |
Species Cow (Bos taurus) [TaxId:9913] [53074] (2 PDB entries) |
Domain d1hlua1: 1hlu A:2-146 [33431] Other proteins in same PDB: d1hlup_ |
PDB Entry: 1hlu (more details), 2.65 Å
SCOP Domain Sequences for d1hlua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlua1 c.55.1.1 (A:2-146) Actin {Cow (Bos taurus)} dddiaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq imfetfntpamyvaiqavlslyasg
Timeline for d1hlua1: