Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein Actin [53073] (10 species) |
Species Cow (Bos taurus) [TaxId:9913] [53074] (3 PDB entries) |
Domain d2btfa2: 2btf A:147-375 [33430] Other proteins in same PDB: d2btfp_ complexed with atp, sr |
PDB Entry: 2btf (more details), 2.55 Å
SCOPe Domain Sequences for d2btfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2btfa2 c.55.1.1 (A:147-375) Actin {Cow (Bos taurus) [TaxId: 9913]} rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf lgmescgihettfnsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf
Timeline for d2btfa2: