SCOP 1.67: Domain d2btfa1: 2btf A:2-146

Lineage for d2btfa1 (2btf A:2-146)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53074] (2 PDB entries)

8. Domain d2btfa1: 2btf A:2-146 [33429]
   Other proteins in same PDB: d2btfp_

Details for d2btfa1

PDB Entry: 2btf, 2.55 Å

PDB Description: the structure of crystalline profilin-beta-actin

SCOP Domain Sequences for d2btfa1:

Sequence; same for both SEQRES and ATOM records:

>d2btfa1 c.55.1.1 (A:2-146) Actin {Cow (Bos taurus)}
dddiaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
imfetfntpamyvaiqavlslyasg

Timeline for d2btfa1:

• d2btfa1 first appeared (with stable ids) in SCOP 1.55
  
• d2btfa1 appears in SCOP 1.65
  
• d2btfa1 appears in SCOP 1.69
  
• d2btfa1 appears in the current release, SCOPe 2.08