Lineage for d5nt7d_ (5nt7 D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452192Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225598] (11 PDB entries)
  8. 2452196Domain d5nt7d_: 5nt7 D: [334244]
    automated match to d2p6na_
    protein/RNA complex

Details for d5nt7d_

PDB Entry: 5nt7 (more details), 1.4 Å

PDB Description: structure of the lotus domain of oskar in complex with the c-terminal reca-like domain of vasa
PDB Compounds: (D:) ATP-dependent RNA helicase vasa, isoform A

SCOPe Domain Sequences for d5nt7d_:

Sequence, based on SEQRES records: (download)

>d5nt7d_ c.37.1.0 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vkqtiyevnkyakrsklieilseqadgtivfvetkrgadflasflsekefpttsihgdrl
qsqreqalrdfkngsmkvliatsvasrgldiknikhvinydmpskiddyvhrigrtgrvg
nngratsffdpekdraiaadlvkilegsgqtvpdflrtc

Sequence, based on observed residues (ATOM records): (download)

>d5nt7d_ c.37.1.0 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vkqtiyevnkyakrsklieilseqadgtivfvetkrgadflasflsekefpttsihgdrl
qsqreqalrdfkngsmkvliatsvasrgldiknikhvinydmpskiddyvhrigrtgrat
sffdpekdraiaadlvkilegsgqtvpdflrtc

SCOPe Domain Coordinates for d5nt7d_:

Click to download the PDB-style file with coordinates for d5nt7d_.
(The format of our PDB-style files is described here.)

Timeline for d5nt7d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5nt7b_