Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [187919] (2 PDB entries) |
Domain d5h5xf_: 5h5x F: [334226] automated match to d4g81a_ complexed with ipa, mg, nai |
PDB Entry: 5h5x (more details), 2.3 Å
SCOPe Domain Sequences for d5h5xf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h5xf_ c.2.1.0 (F:) automated matches {Streptomyces coelicolor [TaxId: 100226]} tgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelraggvea aaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvrtnld gvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaaeyaa rgirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivfllsdrasfva gsyhlvdgaytav
Timeline for d5h5xf_: