Class a: All alpha proteins [46456] (290 folds) |
Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) binds to the transactivation domain of human p53 |
Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins) Pfam PF02201 |
Protein MDM2 [47594] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries) |
Domain d5j7gd_: 5j7g D: [334205] Other proteins in same PDB: d5j7ga2 automated match to d1ttva_ complexed with 6gg |
PDB Entry: 5j7g (more details), 1.85 Å
SCOPe Domain Sequences for d5j7gd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j7gd_ a.42.1.1 (D:) MDM2 {Human (Homo sapiens) [TaxId: 9606]} mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy csndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
Timeline for d5j7gd_:
View in 3D Domains from other chains: (mouse over for more information) d5j7ga1, d5j7ga2, d5j7gb_, d5j7gc_ |